PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g073210.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family FAR1
Protein Properties Length: 233aa    MW: 26320.4 Da    PI: 8.6669
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g073210.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR161.42.7e-1950135290
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         +Y+eYA ++GF +r+ +s+ks+r+g+i++r + C     +++  +     +++r   r gC+a++ vk+ek g+w+v k++ +HnH+l+
  Sopim06g073210.0.1  50 YYDEYAGMTGFITRVLSSRKSERDGSIISRGLGCRGIPDNQRPVSL---VNQKRDRRRDGCTAMILVKREKPGTWVVRKFVRDHNHPLV 135
                         8*********************************876666666555...778888999*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.5E-1750135IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MTMDVHNLED NGAGRVESSA EGQVSTSEAD RTQEPNEGMT FESEEAARAY YDEYAGMTGF  60
ITRVLSSRKS ERDGSIISRG LGCRGIPDNQ RPVSLVNQKR DRRRDGCTAM ILVKREKPGT  120
WVVRKFVRDH NHPLVIPPSK RRPTSDEKDK RIQELTAELR TKKRLTAAYR EQLLSLMKDV  180
ESHSEHLSAK VQAVQSILKE LEAKRQELSN HSGHHKNSRV YTPVESDYDG TD*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241417.11e-160PREDICTED: protein FAR1-RELATED SEQUENCE 2-like
TrEMBLK4C9401e-173K4C940_SOLLC; Uncharacterized protein
STRINGSolyc06g073210.2.11e-173(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130991718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.12e-47FAR1 family protein